PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 750aa    MW: 83628.5 Da    PI: 4.4643
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491350.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.3e-13598639346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW+++E el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
   XP_016491350.1 598 RWSKQETELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 639
                      9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-28589673No hitNo description
PROSITE profilePS5129311.203594642IPR017884SANT domain
SMARTSM007173.1E-10595643IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11597646IPR009057Homeodomain-like
CDDcd001672.74E-8598639No hitNo description
Gene3DG3DSA:1.10.10.606.7E-8598639IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MFNQKEFEWF ILELLSVSVL INLSMDLLDD ILADGASKTV KAGGKFQPKA KPRPVKKGPA  60
VASSTVSLTS KPTGDTVATD SFEALKKDGK NSQNYYEQSS VLAEPSLEHP LAAETLCPSV  120
GSYLDTSTVV PDNSEDSKTC LEKSEGEYAD IYIGLDSFDD LLPTSSAIEN SSPATDPSAV  180
HVDGAEKGQD QLSIPVSSVD DSAPSTSNLQ PDEVAGCQDP LTCQGSVVPV SGSCQMEMDS  240
YPSLEADILG VTTTSGQSTR RFQPKSKLQV YRERYDTSIP DSDAVESVSC QPNSHSVHSE  300
MDFVDRGKEH GFPADDVLDF SARGFDNNII TESTHEFPVH EEYVIEASHS DVRIPAELHE  360
STSQMPEEPV HQRPKTKKQK LPASDLSAIT EENGAGRSLR SRRKSVNANR LVDESEVVAD  420
DGEYVPEQPN DSVTNGNNED LLVENESQGK KVQKKSKRTV AEDGKQVRKS KKTTEASDQA  480
ANKKPKKFSH STRQKRRQVN KALLEAPEYE IDYQKVPIKD LIILGEHRER LAKKDAAASQ  540
IPTTDQSTGA SVSNYNEDET YPSDDGAEDN DHQIGSRAQD SSAYFNYQTY MDKTPSTRWS  600
KQETELFYEA VQQFGTDLSL IQQLFPGRTR RQLKLKYKKE ERQHPFRLHD ALTNRSKDHS  660
HFERVIERLK QIEAEELQKA DKDESIDLTG EQEVEEGTQE INEEEANSEN VEKKEVEAVE  720
QQDVPEMESP IEDYDSEDDS WRWSQYKSEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0488873e-94GU048887.1 Capsicum annuum clone BAC CaCM511O09_Contig, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491350.10.0PREDICTED: uncharacterized protein LOC107811026 isoform X2
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-50MYB_related family protein